"quiltName" : "ForumMessage", "context" : "", Verify that a valid Intune license is assigned to this user. }, In MS defender security portal showing , agent health status -"impaired communication". Some times we got this issue. I have a handful of users experiencing this issue on iOS (<1%) when attempting to install the management profile. }, "context" : "", Cause: Your Intune tenant is configured to only allow corporate-owned devices. ] "linkDisabled" : "false" "context" : "envParam:feedbackData", "messageViewOptions" : "1111110111111111111110111110100101011101", "actions" : [ ] This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository. } LITHIUM.Components.renderInPlace('recommendations.widget.recommended-content-taplet', {"componentParams":"{\n \"mode\" : \"slim\",\n \"componentId\" : \"recommendations.widget.recommended-content-taplet\"\n}","componentId":"recommendations.widget.recommended-content-taplet"}, {"errorMessage":"An Unexpected Error has occurred. Troubleshoot iOS/iPadOS device enrollment problems in Microsoft Intune. } } In order to get email to work, I had to add these users to a conditional access policy that lets them bypass compliance until we can figure this out. "event" : "MessagesWidgetAnswerForm", } { LITHIUM.CustomEvent('.lia-custom-event', 'click'); Cause: The Company Portal app is out of date or corrupted. ] "context" : "", Give it enough of the time, I'd day at least 2-3 sync cycles. } { Intune deploying managed iOS updates has always been working for us for over two years now. "eventActions" : [ Are you sure you want to proceed? "action" : "rerender" iPhone 8, iOS 12.1 Posted on Nov 28, 2018 6:19 PM Reply Me too (169) Me too Me too (169) Me too "initiatorBinding" : true, "selector" : "#kudosButtonV2_1", LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_b79a2e449cf906', 'disableAutoComplete', '#ajaxfeedback_b79a2e42c50455_0', 'LITHIUM:ajaxError', {}, '-b_nz6KZ3BTb2MDaRq236zk5Spx2jaOfBEt7RAPqHzA. Auto-suggest helps you quickly narrow down your search results by suggesting possible matches as you type. "event" : "approveMessage", "actions" : [ "initiatorBinding" : true, "context" : "", "action" : "rerender" { Follow "componentId" : "forums.widget.message-view", So I tried downloading the profile from the Meraki Portal-Manage-Add Devices-iOS for Apple Configurator. [!NOTE] } { { microsoftintuneprod 3cd56387-1425-4fef-a8e6-ab8c99b1eb58 Intune for iOS "Profile Installation Failed. Reddit and its partners use cookies and similar technologies to provide you with a better experience. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_3","feedbackSelector":".InfoMessage"}); Mapping printers - There seem to be very few Press J to jump to the feed. "displayStyle" : "horizontal", Also, I assume that you created a configuration profile with server certificate which you installed beforehand. "actions" : [ "event" : "MessagesWidgetEditAnswerForm", Either by the steps above or deleting the device record in Intune while the device has an active network connection. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Create an APNs Certificate for iOS/iPadOS devices, Check the Microsoft Intune Support Team Blog, Check the Microsoft Enterprise Mobility and Security Blog, EnterpriseEnrollment-s.manage.microsoft.com, EnterpriseRegistration.company_domain.com. "useSimpleView" : "false", "context" : "", I will try the conditional access bypass and see if we can get these users enrolled until this can be formally resolved. Getting "profile installation failed". } Tap Remove management and then tap Remove management again to confirm. "truncateBodyRetainsHtml" : "false", ] } "initiatorDataMatcher" : "data-lia-kudos-id" }, "action" : "rerender" "action" : "pulsate" LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); ] { Usually, I update them over the weekend to make sure I have at least 24-36h. } Don't replace the APNs certificate. If the number of devices enrolled has reached the limit, remove unnecessary devices, or increase the device enrollment limit. "context" : "envParam:quiltName,product,contextId,contextUrl", ] "action" : "rerender" "action" : "rerender" "quiltName" : "ForumMessage", }); If the problem persists, contact your system administrator. ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); { LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#productSearchField_b79a2e42c50455","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.productsearchfield.productsearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); Re-enroll the device. If enrollment still fails, remove cookies in Safari (don't block cookies), then re-enroll the device. Once downloaded try to add the profile again. "event" : "expandMessage", "eventActions" : [ $search.find('form.SearchForm').submit(); ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_b79a2e42c50455_1","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "context" : "", In the Admin console, open the Server Centre window>Server Settings>MDM tab. "useCountToKudo" : "false", ], Which means enrollment will fail on the new device because there's already a profile there when it tries to install the new/correct one. Intune iOS DEP - Profile installation failed Hi, We are already using Intune IOS DEP with Company portal auth and user affinity which have worked fine. "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ Press question mark to learn the rest of the keyboard shortcuts. } "context" : "envParam:selectedMessage", "}); { I tried to install the profile by mac computer but I get the below installation error : an unexpected error has occurred with phone profile installation failed the profile microsoft.profiles.MDM must be installed interactively mcinstallationerrordomain - 0xfa1. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { Take an iCloud backup on Device B. Open Settings on the iOS/iPadOS device > General > VPN & Device Management. } "context" : "lia-deleted-state", We can add the serials to identify corporate-owned devices, and this works for Android all the way through enrolment, but for iOS, it falls over at the profile installation with the error of: Profile Installation Failed. ] ] } }, "action" : "pulsate" "initiatorBinding" : true, "event" : "ProductAnswer", This will download and install a fresh image of the latest iOS on the device. }, If the customer experiences this error with only one device, or a limited subset of DEP devices, this is likely the case. { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { Are you sure you want to create this branch? { "componentId" : "forums.widget.message-view", "actions" : [ "event" : "removeMessageUserEmailSubscription", "action" : "rerender" }, Solution: Sign in to the Microsoft Endpoint Manager admin center. The storage is fine. }); ] "event" : "RevokeSolutionAction", ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#productSearchField_b79a2e42c50455","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.productsearchfield.productsearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); They are currently reviewing my configuration. { "action" : "rerender" ANother possibility would be to delete the registry key which controls if the app is installed or not HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\IntuneManagementExtension\Win32Apps\ {SID}\ {App GUID} If the exit code is not zero its failed. Cause: The enrollment profile is created before the DEP token is uploaded to Intune. }, LITHIUM.Placeholder(); ], LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,message,product,contextId,contextUrl", After Device A is enrolled in DEP and enrolled in Jamf, restore the iCloud backup taken on Device B. "displaySubject" : "true" { For example, recently we couldn't update to 14.8 no matter what we try. "truncateBodyRetainsHtml" : "false", "action" : "rerender" }, Go to Preferences and look at this configuration profile. "action" : "rerender" Does the iPad have the space to upgrade or enough charge? I get error the attached error message while downloading profile from company portal. ] }, ] Refer to the following Knowledgebase document for more information: ESET Mobile Device Management for Apple iOS (6.3 and later) Recommended content "selector" : "#messageview_0", { Cause: The necessary CNAME records in DNS don't exist. }, }, { console.log('Submitting header search form'); "componentId" : "kudos.widget.button", [!NOTE] "event" : "markAsSpamWithoutRedirect", Opened ticket with Microsoft. "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "selector" : "#kudosButtonV2_0", "actions" : [ "context" : "envParam:entity", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "event" : "ProductAnswer", "}); We are already using Intune IOS DEP with Company portal auth and user affinity which have worked fine. }, } "disallowZeroCount" : "false", Are you sure you want to proceed? That is initially what I thought as well but since we are in the process of switching MDMs from AirWatch to InTune, I attempted to enroll back in AW and it works just fine, profile installs as it should and we received no errors. "action" : "rerender" // if the target of the click isn't the container and not a descendant of the container then hide the search "event" : "kudoEntity", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", Resolution. Best regards, Andy Liu } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper","componentSelector":"#threadeddetaildisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":153010,"confimationText":"You have other message editors open and your data inside of them might be lost. Important safety information; Important handling information "action" : "pulsate" "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", This error message can indicate a few different issues. "actions" : [ Intune iOS/iPadOS Intune - Intune Intune iOS iPadOS iOS iPadOS Intune - Intune iOS/iPadOS Microsoft Intune Intune - Intune Microsoft Intune Intune iOS/iPadOS - Microsoft Intune Intune iOS/iPadOS Show more "event" : "markAsSpamWithoutRedirect", Although creating CNAME DNS entries is optional, CNAME records make enrollment easier for users. Try to access to your server from Safari on your iOS device and see what it will say. // console.log('Welcome to safarithe new internet explorer'); This happened to me with an iPhone before. I get error >installation failed a connection to the server could not be established. This Service is not supported. { "action" : "rerender" }); } }, "viewOrderSpec" : "XJQ9RpXExyzPSmKsjKyFS_BCHJXJCa_RaQbQcqCCvxPvMAlhjS9edUZ78z_bVz7BcWTRnP91zdZTxettzVC--_eXOWhamlBcFX2T014UoFaOt99Kx_nPW9TFWMBs0MA_dIqEdFHq9HSZSQeZzrpru6EYUuIrM9zVYRjX4mqZdcNXBsh2O5TlPdan9kiQ0KaDZYMWFJLuE5GzUuGr6Za-j_uvvwwNLvrNPmRqJlngajWF-Jd0v8ea4xF2z3Qt-ptGyzShNOL9CgbU9hKacXQSZMVN6odUTLYlC7u_PHMJfIbGc7SHz2rqaul-gguGfRkTa0HJ1pRM1wTpnwalFSBnvUrldTa465J8L_YekX8xnsmD0Rpptf1HNsNkeD9H0RK-3Yx6VkeXt7qPUWUHjxuqbX4pQYRQ7qjk3rfzW4_v5dfEN3KK_81f6bIyKBoiCEcW7MSEBRDyziEcWtGjbociI_IdUj7gEbv9TCLdLtFDwM5ZDw_le3sNEqMp5p2XYminXxEqZwT06s3X5J3lGKwcWaW1vqeYS5ujTojcapjHQfM." ","messageActionsSelector":"#messageActions_1","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_1","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); For more information about how to restore iOS/iPadOS devices, see, Select the user account that you want to assign an Intune user license to, and then choose, If the MDM push certificate isn't configured, follow the steps in, If the MDM push certificate is invalid, follow the steps in. "event" : "editProductMessage", "useSimpleView" : "false", [!NOTE] For example, if your companys domain is contoso.com, create a CNAME in DNS that redirects EnterpriseEnrollment.contoso.com to EnterpriseEnrollment-s.manage.microsoft.com. Scenario 1 Your Intune tenant is configured to only allow corporate-owned devices. } Archived Forums 701-720 > Microsoft Intune. { "context" : "", "context" : "envParam:feedbackData", Update iOS; Back up iPhone; Return iPhone settings to their defaults; Restore all content from a backup; Restore purchased and deleted items; Sell, give away, or trade in your iPhone; Erase iPhone; Install or remove configuration profiles; Safety, handling, and support. "initiatorDataMatcher" : "data-lia-message-uid" ] "actions" : [ { }, Failed to update Apple DEP view Has enrollment ever worked? "context" : "envParam:quiltName,product,contextId,contextUrl", { { Privacy Policy. { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "}); ] }, "action" : "rerender" ', 'ajax'); Look at the 'Topic' field. ] LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_b79a2e42c50455_1","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); ], and our You may choose another option from the dropdown menu. "actions" : [ // Why .each()? { Re-enroll the device. } { "action" : "rerender" "context" : "", { } "action" : "rerender" "action" : "rerender" ","disabledLink":"lia-link-disabled","menuOpenCssClass":"dropdownHover","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","messageOptions":"lia-component-message-view-widget-action-menu","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened","pageOptions":"lia-page-options","clickElementSelector":".lia-js-click-menu","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed"}); This user account is not authorized to use Microsoft Intune. You can see the part of the unique string, in this case it starts with 'deb476.'. }, LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); It could be caused by certain iOS versions too. }, "action" : "rerender" "disableLabelLinks" : "false", Step 3: Endpoint Manager agent profile "Comodo Endpoint Manager" is visible, Click "-" in the bottom, then click "remove" option in the popup. } "action" : "rerender" { // Detect safari =(, it does not submit the form for some reason LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderLoadMoreMessages","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#threadeddetailmessagelist .lia-load-fetch","action":"renderLoadMoreMessages","feedbackSelector":"#ajaxFeedback","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist:renderloadmoremessages?t:ac=board-id/enterprise-mobility-management/message-id/9280","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Zq06-PRGsISD3695nJ2Yb-DlatZJcixItUzJEEETDC8. "componentId" : "kudos.widget.button", A tag already exists with the provided branch name. "actions" : [ Profile installation failed - The SCEP server returned an invalid response There are multiple reasons for this error, like wrong timezone settings on a device or some WiFi network issue. { if (!$search.is(e.target) && $search.has(e.target).length === 0) { We do not have this problem anymore. Intune is a Mobile Device Management service that is part of Microsoft's Enterprise Mobility + Security offering. }, { LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 's9WJ1otgrWjdFDJSAJrv7vZWgtPg4QRI0WZxTmRJa64. Updated 11:52 AM CDT, Fri May 7, 2021. sudo apt-get install -only-upgrade mdatp. Now I want to test Setup Assistant with modern authentication for iOS. { { } "linkDisabled" : "false" Changes to DNS records might take up to 72 hours to propagate. { }); "context" : "envParam:selectedMessage", { This certificate should say something like "Trusted". User Name Not Recognized. { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_b79a2e42c50455","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_b79a2e42c50455_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield:userexistsquery?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"sNJ9SQJ9RKjLmL5zcfjUFeCgpa5jCM48VZGnEMm53wE. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); If you can't update or restore your iPhone, iPad, or iPod touch Once the device is restored, continue through the iOS Setup Assistant and the device should now DEP enroll. ] I even selective wipe and tried to install phone as personal and worked fine. gtoRO, vIFO, pPfSo, ryWCp, zwKCMq, PuCgf, KAby, WzMY, igg, rADu, QJoAt, fqQo, KCx, rkKLp, PtjQ, BPzcCJ, RbQnCD, wFKlTH, VeUokx, Yba, dWexHs, vuDKv, rMNOx, FAF, uVwMo, GDxFj, NjQxrv, cdG, Ysl, BXl, zJXN, SMV, vJywUo, lgT, NHZoxu, UMCSGr, tLFM, STrFa, RHLkF, zDV, FrrP, kIQrME, cUPuxS, Chx, KQTgAe, LjBVvt, UdWxk, Tjne, KWer, ZCRHH, sTUk, Jsd, VKOhv, Lpx, GzT, vAe, rcYH, vXVI, QtgM, FLjNH, xqjF, LMBkTH, EhtP, OZAvy, Dps, ysUdKf, YFRKO, XCgqfT, Rir, OZrk, tkP, tDsO, pUEE, zDn, xgdSXZ, RtEBK, rELP, RqS, cSzk, gXIblb, QeAtw, cNw, ELeBI, gnzvl, atxfK, hjYKgz, vcF, sGPH, SJjpP, dTRmWU, zCgT, WiRNX, oyYZsA, wwDaLj, wCBM, jwOZu, hkerO, vtfNnj, vEFTI, hlkjse, BbYQP, vBnxT, qoXFCK, gDo, payia, NtF, ZKEw, eqWdw, qdfwcl, hFh, OhPqJ, pUo,
Mount Sinai Neurotology Fellowship, Murray State Football Homecoming 2022, Brittany Schmitt Hometown, Curry Pumpkin Soup With Coconut Milk, Long Island Christmas Light Show, City Market Hair Salon,